PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011667.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 297aa    MW: 32418.2 Da    PI: 9.3106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011667.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.61.1e-072312691755
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 A+rsR RK+++i+eLe +v++L++e  +   e+e l+++
  Do011667.1 231 AQRSRVRKLQYIAELESRVQALQSEGVEVSAEMEFLTQQ 269
                 89***********************99888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-6220279IPR004827Basic-leucine zipper domain
CDDcd147032.49E-14221271No hitNo description
SuperFamilySSF579591.48E-6230273No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-6231273No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MMMTNAKLQK QALLPPRSPF PTAAAAPSPY ADRGPIARPQ GAAAHHRHGH GHHQRTSSES  60
FIEEQPPSWL DDLLNEPESP VVRQHGRAGH RRSSSDSFAL FDGGAAGAGA YANGFEGMGG  120
GGGQPAPWGG VRVQEYYAKP GSFGRAHSRP WEQGMPNLAG FRHGGGLPMP AKDKVGGHHG  180
PPNMLRDHDH GMDKRTPDDA GHDHKVGAKE GVPLKHAQSE ADNKRAKQQY AQRSRVRKLQ  240
YIAELESRVQ ALQSEGVEVS AEMEFLTQQN IMLDLENKAL KQRLESLAQE QLIKRCE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9751020.0EU975102.1 Zea mays clone 469036 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152361.11e-166uncharacterized protein LOC100286001
RefseqXP_004979095.11e-166PREDICTED: uncharacterized protein At4g06598-like
TrEMBLB6UCY71e-166B6UCY7_MAIZE; DNA binding protein
TrEMBLK3ZJ081e-166K3ZJ08_SETIT; Uncharacterized protein
STRINGSi026561m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-30bZIP family protein